Overview
- Name:
- Apelin 36, human
- Description:
- Apelin, which is encoded by the APLN gene, is the endogenous ligand for the G-protein-coupled APJ receptor. It is widely expressed in various organs such as the heart, lung, kidney, liver, adipose tissue, gastrointestinal tract, brain, adrenal glands, endothelium, and human plasma. The apelin pre-proprotein peptide potentially gives rise to several active fragments. Apelin 36 is a 36 amino acid peptide fragment corresponding to the sequence 42-77.
- Sequence:
- LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
- 3-letter-code:
- Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe
- Molecular weight:
- 4195.89