Overview
- Name:
- Beta Amyloid 1-40
- Description:
- Beta Amyloid peptides are derived from amyloid precursor protein (APP) and are thought to play a role in the development of the senile plaques associated with Alzheimer's Disease.
- Sequence:
- DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
- 3-letter-code:
- Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val
- Molecular weight:
- 4329.86
- Counter ion:
- TFA
References
Englund, H., Brundin, R. M., Hedlund, M., Kilander, L., & Lannfelt, L. (2009). Oligomerization partially explains the lowering of A?42 in alzheimer’s disease cerebrospinal fluid. Neurodegenerative Diseases, 6(4), 139-147.
Santos, D. B., Peres, K. C., Ribeiro, R. P., Colle, D., Santos, A. A. D., Moreira, E. L.G,Souze, D.O.G., Figueiredo, C.P. & Farina, M. (2012). Probucol, a lipid-lowering drug, prevents cognitive and hippocampal synaptic impairments induced by amyloid ? peptide in mice. Experimental neurology, 233(2), 767-775.