Overview
- Name:
- LL-37 (acetate)
- Description:
- The cathelicidin anti-microbial peptide LL-37 corresponds to aa 134-170 of the human cationic antimicrobial protein 18 (hCAP18).
- Sequence:
- (NH2-) [LL-37, 37 aa] (-COOH)
- 3-letter-code:
- Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser
- Molecular weight:
- 4493.33
- Counter ion:
- Acetate
- Solubilization:
- Soluble in pure water.
References
M. Chromek, Z. Slamová, P. Bergman, L. Kovács, L. Podracká, I. Ehrén, T. Hökfelt, G.H. Gudmundsson, R.L. Gallo, B. Agerberth & A. Brauner. 2006. The antimicrobial peptide cathelicidin protects the urinary tract against invasive bacterial infection. Nature Medicine 2006 12:636-641
L. Bandholtz, G. Jacobsson Ekman, M. Vilhelmsson, E. Buentke, B. Agerberth, A. Scheynius, G. H. Gudmundsson. 2006. Antimicrobial Peptide LL-37 Internalized by Immature Human Dendritic Cells Alters their Phenotype. Scandinavian Journal of Immunology 63 (6), 410–419.
