Overview
- Name:
- LL-37 scrambled
- Description:
- The cathelicidin anti-microbial peptide LL-37 corresponds to aa 134-170 of the human cationic antimicrobial protein 18 (hCAP18). This peptide is the scrambled version.
- Sequence:
- (NH2-) GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR (-COOH)
- 3-letter-code:
- Gly-Leu-Lys-Leu-Arg-Phe-Glu-Phe-Ser-Lys-Ile-Lys-Gly-Glu-Phe-Leu-Lys-Thr-Pro-Glu-Val-Arg-Phe-Arg-Asp-Ile-Lys-Leu-Lys-Asp-Asn-Arg-Ile-Ser-Val-Gln-Arg
- Molecular weight:
- 4493.33
- Counter ion:
- TFA
- Solubilization:
- Soluble in pure water.
- Notes:
- Scrambled version of LL-37.
References
L. Bandholtz, G. Jacobsson Ekman, M. Vilhelmsson, E. Buentke, B. Agerberth, A. Scheynius, G. H. Gudmundsson. 2006. Antimicrobial Peptide LL-37 Internalized by Immature Human Dendritic Cells Alters their Phenotype
Scandinavian Journal of Immunology 63 (6), 410–419.