Showing 71–77 of 77 results
Category
-
Apelin 13, Pyr1, V5
- Sequence:
- (Pyr)RPRFSHKGPMPF
- Cat. No.
- SP-5162
- View product
-
Apelin 13, Pyr1, V6
- Sequence:
- (Pyr)RPRLVHKGPMPF
- Cat. No.
- SP-5165
- View product
-
Apelin 13, Pyr1, Y6
- Sequence:
- (Pyr)RPRLYHKGPMPF
- Cat. No.
- SP-5167
- View product
-
Apelin 13, Pyr1, Y7
- Sequence:
- (Pyr)RPRLSYKGPMPF
- Cat. No.
- SP-5151
- View product
-
Apelin 13, stearoyl
- Sequence:
- QRPRLSHKGPMPF
- Cat. No.
- SP-5127
- View product
-
Apelin 17, human
- Description:
- Apelin, which is encoded by the APLN gene, is the endogenous ligand for the G-protein-coupled APJ receptor. It is widely expressed in...
- Sequence:
- KFRRQRPRLSHKGPMPF
- Cat. No.
- SP-5119
- View product
-
Apelin 36, human
- Description:
- Apelin, which is encoded by the APLN gene, is the endogenous ligand for the G-protein-coupled APJ receptor. It is widely expressed in...
- Sequence:
- LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
- Cat. No.
- SP-5118
- View product