Showing 11–20 of 482 results
-
Apelin 13, Pyr1 – Alanine scan
- Description:
- This set of twelve peptides forms a complete Alanine scan of Apelin 13. The amount states the amount delivered of each of...
- Cat. No.
- SP-5128
- View product
-
Beta Amyloid 11-40
- Sequence:
- EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
- Cat. No.
- SP-BA1140
- View product
-
Beta Amyloid 1-42; E22Q
- Sequence:
- DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVVIA
- Cat. No.
- SP-BA42Q22
- View product
-
Wrap53 C1
- Description:
- Polyclonal antibody raised against a synthetic Human Wrap53 peptide that maps to the C1 region of the full length Wrap53 protein. Applications...
- Type:
- Polyclonal IgG
- Cat. No.
- PA-2010
- View product
-
LL-37 biotin
- Type:
- Polyclonal IgG
- Cat. No.
- PA-LL37BT
- View product
-
Caspase 6 substrate Z-AFC
- Sequence:
- VEID
- Cat. No.
- SP-4999
- View product
-
Beta Amyloid 31-34 propionyl
- Sequence:
- IIGL
- Cat. No.
- SP-5037
- View product
-
Melittin
- Sequence:
- GIGAVLKVLTTGLPALISWIKRKRQQ
- Cat. No.
- SP-5090
- View product
-
Apelin 13, Pyr1, E2
- Sequence:
- (Pyr)EPRLSHKGPMPF
- Cat. No.
- SP-5149
- View product
-
Apelin 13, Pyr1, D6, T12
- Sequence:
- (Pyr)RPRLDHKGPMTF
- Cat. No.
- SP-5183
- View product
